Lineage for d1jz8a5 (1jz8 A:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439329Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2439337Species Escherichia coli [TaxId:562] [51511] (45 PDB entries)
    Uniprot P00722
  8. 2439374Domain d1jz8a5: 1jz8 A:334-625 [67834]
    Other proteins in same PDB: d1jz8a1, d1jz8a2, d1jz8a3, d1jz8a4, d1jz8b1, d1jz8b2, d1jz8b3, d1jz8b4, d1jz8c1, d1jz8c2, d1jz8c3, d1jz8c4, d1jz8d1, d1jz8d2, d1jz8d3, d1jz8d4
    complexed with dms, lak, mg, na, tar

Details for d1jz8a5

PDB Entry: 1jz8 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with allolactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1jz8a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1jz8a5:

Click to download the PDB-style file with coordinates for d1jz8a5.
(The format of our PDB-style files is described here.)

Timeline for d1jz8a5: