Lineage for d1jz8a3 (1jz8 A:13-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2383919Protein beta-Galactosidase [49804] (3 species)
  7. 2383927Species Escherichia coli [TaxId:562] [49805] (45 PDB entries)
    Uniprot P00722
  8. 2383964Domain d1jz8a3: 1jz8 A:13-219 [67832]
    Other proteins in same PDB: d1jz8a1, d1jz8a2, d1jz8a4, d1jz8a5, d1jz8b1, d1jz8b2, d1jz8b4, d1jz8b5, d1jz8c1, d1jz8c2, d1jz8c4, d1jz8c5, d1jz8d1, d1jz8d2, d1jz8d4, d1jz8d5
    complexed with dms, lak, mg, na, tar

Details for d1jz8a3

PDB Entry: 1jz8 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with allolactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1jz8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz8a3 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jz8a3:

Click to download the PDB-style file with coordinates for d1jz8a3.
(The format of our PDB-style files is described here.)

Timeline for d1jz8a3: