Lineage for d1jz7d4 (1jz7 D:731-1023)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165166Superfamily b.30.5: Galactose mutarotase-like [74650] (4 families) (S)
  5. 165167Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 165168Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 165169Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 165177Domain d1jz7d4: 1jz7 D:731-1023 [67828]
    Other proteins in same PDB: d1jz7a1, d1jz7a2, d1jz7a3, d1jz7a5, d1jz7b1, d1jz7b2, d1jz7b3, d1jz7b5, d1jz7c1, d1jz7c2, d1jz7c3, d1jz7c5, d1jz7d1, d1jz7d2, d1jz7d3, d1jz7d5

Details for d1jz7d4

PDB Entry: 1jz7 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galactose

SCOP Domain Sequences for d1jz7d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz7d4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jz7d4:

Click to download the PDB-style file with coordinates for d1jz7d4.
(The format of our PDB-style files is described here.)

Timeline for d1jz7d4: