SCOPe 2.02: Domain d1jz7d2: 1jz7 D:626-730

Lineage for d1jz7d2 (1jz7 D:626-730)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
   Uniprot P00722

8. Domain d1jz7d2: 1jz7 D:626-730 [67826]
   Other proteins in same PDB: d1jz7a3, d1jz7a4, d1jz7a5, d1jz7b3, d1jz7b4, d1jz7b5, d1jz7c3, d1jz7c4, d1jz7c5, d1jz7d3, d1jz7d4, d1jz7d5
   complexed with dms, gal, mg, na

Details for d1jz7d2

PDB Entry: 1jz7, 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galactose

PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jz7d2:

Sequence; same for both SEQRES and ATOM records:

>d1jz7d2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1jz7d2:

• d1jz7d2 first appeared in SCOP 1.59
  
• d1jz7d2 appears in SCOPe 2.01
  
• d1jz7d2 appears in SCOPe 2.03
  
• d1jz7d2 appears in the current release, SCOPe 2.08