Lineage for d1jz7b3 (1jz7 B:13-219)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305080Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1305081Protein beta-Galactosidase [49804] (2 species)
  7. 1305089Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
    Uniprot P00722
  8. 1305095Domain d1jz7b3: 1jz7 B:13-219 [67817]
    Other proteins in same PDB: d1jz7a1, d1jz7a2, d1jz7a4, d1jz7a5, d1jz7b1, d1jz7b2, d1jz7b4, d1jz7b5, d1jz7c1, d1jz7c2, d1jz7c4, d1jz7c5, d1jz7d1, d1jz7d2, d1jz7d4, d1jz7d5
    complexed with dms, gal, mg, na

Details for d1jz7b3

PDB Entry: 1jz7 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galactose
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jz7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz7b3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jz7b3:

Click to download the PDB-style file with coordinates for d1jz7b3.
(The format of our PDB-style files is described here.)

Timeline for d1jz7b3: