Lineage for d1jz7b1 (1jz7 B:220-333)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105419Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 105420Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 105421Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 105422Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 105433Domain d1jz7b1: 1jz7 B:220-333 [67815]
    Other proteins in same PDB: d1jz7a3, d1jz7a4, d1jz7a5, d1jz7b3, d1jz7b4, d1jz7b5, d1jz7c3, d1jz7c4, d1jz7c5, d1jz7d3, d1jz7d4, d1jz7d5

Details for d1jz7b1

PDB Entry: 1jz7 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galactose

SCOP Domain Sequences for d1jz7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz7b1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jz7b1:

Click to download the PDB-style file with coordinates for d1jz7b1.
(The format of our PDB-style files is described here.)

Timeline for d1jz7b1: