Lineage for d1jz6b3 (1jz6 B:13-219)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662086Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 662087Protein beta-Galactosidase [49804] (2 species)
  7. 662095Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
  8. 662141Domain d1jz6b3: 1jz6 B:13-219 [67797]
    Other proteins in same PDB: d1jz6a1, d1jz6a2, d1jz6a4, d1jz6a5, d1jz6b1, d1jz6b2, d1jz6b4, d1jz6b5, d1jz6c1, d1jz6c2, d1jz6c4, d1jz6c5, d1jz6d1, d1jz6d2, d1jz6d4, d1jz6d5

Details for d1jz6b3

PDB Entry: 1jz6 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole
PDB Compounds: (B:) beta-galactosidase

SCOP Domain Sequences for d1jz6b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz6b3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jz6b3:

Click to download the PDB-style file with coordinates for d1jz6b3.
(The format of our PDB-style files is described here.)

Timeline for d1jz6b3: