Lineage for d1jz6b2 (1jz6 B:626-730)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) 
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) 
Domain d1jz6b2: 1jz6 B:626-730 [67796]
Other proteins in same PDB: d1jz6a3, d1jz6a4, d1jz6a5, d1jz6b3, d1jz6b4, d1jz6b5, d1jz6c3, d1jz6c4, d1jz6c5, d1jz6d3, d1jz6d4, d1jz6d5
Details for d1jz6b2
PDB Entry: 1jz6 (more details), 2.1 Å
PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole
SCOP Domain Sequences for d1jz6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz6b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOP Domain Coordinates for d1jz6b2:
Click to download the PDB-style file with coordinates for d1jz6b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jz6b2:
- d1jz6b2 is new in SCOP 1.59
- d1jz6b2 appears in SCOP 1.61
- d1jz6b2 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jz6b1, d1jz6b3, d1jz6b4, d1jz6b5 |
