Lineage for d1jz6b1 (1jz6 B:220-333)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105419Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 105420Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 105421Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 105422Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 105505Domain d1jz6b1: 1jz6 B:220-333 [67795]
    Other proteins in same PDB: d1jz6a3, d1jz6a4, d1jz6a5, d1jz6b3, d1jz6b4, d1jz6b5, d1jz6c3, d1jz6c4, d1jz6c5, d1jz6d3, d1jz6d4, d1jz6d5

Details for d1jz6b1

PDB Entry: 1jz6 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole

SCOP Domain Sequences for d1jz6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz6b1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jz6b1:

Click to download the PDB-style file with coordinates for d1jz6b1.
(The format of our PDB-style files is described here.)

Timeline for d1jz6b1: