Lineage for d1jz6a4 (1jz6 A:731-1023)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109072Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 109073Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 109074Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 109075Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 109116Domain d1jz6a4: 1jz6 A:731-1023 [67793]
    Other proteins in same PDB: d1jz6a1, d1jz6a2, d1jz6a3, d1jz6a5, d1jz6b1, d1jz6b2, d1jz6b3, d1jz6b5, d1jz6c1, d1jz6c2, d1jz6c3, d1jz6c5, d1jz6d1, d1jz6d2, d1jz6d3, d1jz6d5

Details for d1jz6a4

PDB Entry: 1jz6 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole

SCOP Domain Sequences for d1jz6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz6a4 b.30.1.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jz6a4:

Click to download the PDB-style file with coordinates for d1jz6a4.
(The format of our PDB-style files is described here.)

Timeline for d1jz6a4: