Lineage for d1jz5d4 (1jz5 D:731-1023)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109072Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 109073Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 109074Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 109075Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 109111Domain d1jz5d4: 1jz5 D:731-1023 [67788]
    Other proteins in same PDB: d1jz5a1, d1jz5a2, d1jz5a3, d1jz5a5, d1jz5b1, d1jz5b2, d1jz5b3, d1jz5b5, d1jz5c1, d1jz5c2, d1jz5c3, d1jz5c5, d1jz5d1, d1jz5d2, d1jz5d3, d1jz5d5

Details for d1jz5d4

PDB Entry: 1jz5 (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1-on

SCOP Domain Sequences for d1jz5d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz5d4 b.30.1.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jz5d4:

Click to download the PDB-style file with coordinates for d1jz5d4.
(The format of our PDB-style files is described here.)

Timeline for d1jz5d4: