SCOPe 2.01: Domain d1jz5d2: 1jz5 D:626-730

Lineage for d1jz5d2 (1jz5 D:626-730)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
   Uniprot P00722

8. Domain d1jz5d2: 1jz5 D:626-730 [67786]
   Other proteins in same PDB: d1jz5a3, d1jz5a4, d1jz5a5, d1jz5b3, d1jz5b4, d1jz5b5, d1jz5c3, d1jz5c4, d1jz5c5, d1jz5d3, d1jz5d4, d1jz5d5
   complexed with 149, dms, mg, na

Details for d1jz5d2

PDB Entry: 1jz5, 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1- on

PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jz5d2:

Sequence; same for both SEQRES and ATOM records:

>d1jz5d2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1jz5d2:

• d1jz5d2 first appeared in SCOP 1.59
  
• d1jz5d2 appears in SCOP 1.75
  
• d1jz5d2 appears in SCOPe 2.02
  
• d1jz5d2 appears in the current release, SCOPe 2.08