Lineage for d1jz5d1 (1jz5 D:220-333)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110264Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 1110265Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1110266Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1110280Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
    Uniprot P00722
  8. 1110359Domain d1jz5d1: 1jz5 D:220-333 [67785]
    Other proteins in same PDB: d1jz5a3, d1jz5a4, d1jz5a5, d1jz5b3, d1jz5b4, d1jz5b5, d1jz5c3, d1jz5c4, d1jz5c5, d1jz5d3, d1jz5d4, d1jz5d5
    complexed with 149, dms, mg, na

Details for d1jz5d1

PDB Entry: 1jz5 (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1- on
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jz5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz5d1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jz5d1:

Click to download the PDB-style file with coordinates for d1jz5d1.
(The format of our PDB-style files is described here.)

Timeline for d1jz5d1: