Lineage for d1jz5c3 (1jz5 C:13-219)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107983Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 107984Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families) (S)
  5. 108022Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 108023Protein beta-Galactosidase [49804] (1 species)
  7. 108024Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 108059Domain d1jz5c3: 1jz5 C:13-219 [67782]
    Other proteins in same PDB: d1jz5a1, d1jz5a2, d1jz5a4, d1jz5a5, d1jz5b1, d1jz5b2, d1jz5b4, d1jz5b5, d1jz5c1, d1jz5c2, d1jz5c4, d1jz5c5, d1jz5d1, d1jz5d2, d1jz5d4, d1jz5d5

Details for d1jz5c3

PDB Entry: 1jz5 (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1-on

SCOP Domain Sequences for d1jz5c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz5c3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jz5c3:

Click to download the PDB-style file with coordinates for d1jz5c3.
(The format of our PDB-style files is described here.)

Timeline for d1jz5c3: