![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
![]() | Domain d1jz5c1: 1jz5 C:220-333 [67780] Other proteins in same PDB: d1jz5a3, d1jz5a4, d1jz5a5, d1jz5b3, d1jz5b4, d1jz5b5, d1jz5c3, d1jz5c4, d1jz5c5, d1jz5d3, d1jz5d4, d1jz5d5 complexed with 149, dms, mg, na |
PDB Entry: 1jz5 (more details), 1.8 Å
SCOPe Domain Sequences for d1jz5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz5c1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d1jz5c1:
![]() Domains from same chain: (mouse over for more information) d1jz5c2, d1jz5c3, d1jz5c4, d1jz5c5 |