Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.3: beta-glycanases [51487] (26 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (25 PDB entries) Uniprot P00722 |
Domain d1jz5b5: 1jz5 B:334-625 [67779] Other proteins in same PDB: d1jz5a1, d1jz5a2, d1jz5a3, d1jz5a4, d1jz5b1, d1jz5b2, d1jz5b3, d1jz5b4, d1jz5c1, d1jz5c2, d1jz5c3, d1jz5c4, d1jz5d1, d1jz5d2, d1jz5d3, d1jz5d4 |
PDB Entry: 1jz5 (more details), 1.8 Å
SCOP Domain Sequences for d1jz5b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz5b5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jz5b5:
View in 3D Domains from same chain: (mouse over for more information) d1jz5b1, d1jz5b2, d1jz5b3, d1jz5b4 |