Lineage for d1jz5b4 (1jz5 B:731-1023)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782344Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 1782345Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 1782353Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 1782391Domain d1jz5b4: 1jz5 B:731-1023 [67778]
    Other proteins in same PDB: d1jz5a1, d1jz5a2, d1jz5a3, d1jz5a5, d1jz5b1, d1jz5b2, d1jz5b3, d1jz5b5, d1jz5c1, d1jz5c2, d1jz5c3, d1jz5c5, d1jz5d1, d1jz5d2, d1jz5d3, d1jz5d5
    complexed with 149, dms, mg, na

Details for d1jz5b4

PDB Entry: 1jz5 (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1- on
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jz5b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz5b4 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jz5b4:

Click to download the PDB-style file with coordinates for d1jz5b4.
(The format of our PDB-style files is described here.)

Timeline for d1jz5b4: