Lineage for d1jz5b2 (1jz5 B:626-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1521825Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1521839Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
    Uniprot P00722
  8. 1521915Domain d1jz5b2: 1jz5 B:626-730 [67776]
    Other proteins in same PDB: d1jz5a3, d1jz5a4, d1jz5a5, d1jz5b3, d1jz5b4, d1jz5b5, d1jz5c3, d1jz5c4, d1jz5c5, d1jz5d3, d1jz5d4, d1jz5d5
    complexed with 149, dms, mg, na

Details for d1jz5b2

PDB Entry: 1jz5 (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1-on
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jz5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz5b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1jz5b2:

Click to download the PDB-style file with coordinates for d1jz5b2.
(The format of our PDB-style files is described here.)

Timeline for d1jz5b2: