Lineage for d1jz5b2 (1jz5 B:626-730)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) 
Domain d1jz5b2: 1jz5 B:626-730 [67776]
Other proteins in same PDB: d1jz5a3, d1jz5a4, d1jz5a5, d1jz5b3, d1jz5b4, d1jz5b5, d1jz5c3, d1jz5c4, d1jz5c5, d1jz5d3, d1jz5d4, d1jz5d5
Details for d1jz5b2
PDB Entry: 1jz5 (more details), 1.8 Å
PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1- on
SCOP Domain Sequences for d1jz5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz5b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOP Domain Coordinates for d1jz5b2:
Click to download the PDB-style file with coordinates for d1jz5b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jz5b2:
- d1jz5b2 first appeared in SCOP 1.59
- d1jz5b2 appears in SCOP 1.63
- d1jz5b2 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jz5b1, d1jz5b3, d1jz5b4, d1jz5b5 |
