![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (45 PDB entries) Uniprot P00722 |
![]() | Domain d1jz4c3: 1jz4 C:13-219 [67762] Other proteins in same PDB: d1jz4a1, d1jz4a2, d1jz4a4, d1jz4a5, d1jz4b1, d1jz4b2, d1jz4b4, d1jz4b5, d1jz4c1, d1jz4c2, d1jz4c4, d1jz4c5, d1jz4d1, d1jz4d2, d1jz4d4, d1jz4d5 complexed with 2dg, dms, mg, na |
PDB Entry: 1jz4 (more details), 2.1 Å
SCOPe Domain Sequences for d1jz4c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz4c3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1jz4c3:
![]() Domains from same chain: (mouse over for more information) d1jz4c1, d1jz4c2, d1jz4c4, d1jz4c5 |