Lineage for d1jz4c3 (1jz4 C:13-219)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305080Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1305081Protein beta-Galactosidase [49804] (2 species)
  7. 1305089Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
    Uniprot P00722
  8. 1305136Domain d1jz4c3: 1jz4 C:13-219 [67762]
    Other proteins in same PDB: d1jz4a1, d1jz4a2, d1jz4a4, d1jz4a5, d1jz4b1, d1jz4b2, d1jz4b4, d1jz4b5, d1jz4c1, d1jz4c2, d1jz4c4, d1jz4c5, d1jz4d1, d1jz4d2, d1jz4d4, d1jz4d5
    complexed with 2dg, dms, mg, na

Details for d1jz4c3

PDB Entry: 1jz4 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl-enzyme intermediate (low bis-tris)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz4c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz4c3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jz4c3:

Click to download the PDB-style file with coordinates for d1jz4c3.
(The format of our PDB-style files is described here.)

Timeline for d1jz4c3: