Lineage for d1jz4c2 (1jz4 C:626-730)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036363Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2036364Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2036378Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2036536Domain d1jz4c2: 1jz4 C:626-730 [67761]
    Other proteins in same PDB: d1jz4a3, d1jz4a4, d1jz4a5, d1jz4b3, d1jz4b4, d1jz4b5, d1jz4c3, d1jz4c4, d1jz4c5, d1jz4d3, d1jz4d4, d1jz4d5
    complexed with 2dg, dms, mg, na

Details for d1jz4c2

PDB Entry: 1jz4 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl-enzyme intermediate (low bis-tris)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz4c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1jz4c2:

Click to download the PDB-style file with coordinates for d1jz4c2.
(The format of our PDB-style files is described here.)

Timeline for d1jz4c2: