Lineage for d1jz4c1 (1jz4 C:220-333)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936216Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 936217Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 936218Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 936232Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
    Uniprot P00722
  8. 936325Domain d1jz4c1: 1jz4 C:220-333 [67760]
    Other proteins in same PDB: d1jz4a3, d1jz4a4, d1jz4a5, d1jz4b3, d1jz4b4, d1jz4b5, d1jz4c3, d1jz4c4, d1jz4c5, d1jz4d3, d1jz4d4, d1jz4d5
    complexed with 2dg, dms, mg, na

Details for d1jz4c1

PDB Entry: 1jz4 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl-enzyme intermediate (low bis-tris)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz4c1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jz4c1:

Click to download the PDB-style file with coordinates for d1jz4c1.
(The format of our PDB-style files is described here.)

Timeline for d1jz4c1: