Lineage for d1jz4b1 (1jz4 B:220-333)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366897Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 366898Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 366899Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 366900Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 366991Domain d1jz4b1: 1jz4 B:220-333 [67755]
    Other proteins in same PDB: d1jz4a3, d1jz4a4, d1jz4a5, d1jz4b3, d1jz4b4, d1jz4b5, d1jz4c3, d1jz4c4, d1jz4c5, d1jz4d3, d1jz4d4, d1jz4d5

Details for d1jz4b1

PDB Entry: 1jz4 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl-enzyme intermediate (low bis-tris)

SCOP Domain Sequences for d1jz4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz4b1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jz4b1:

Click to download the PDB-style file with coordinates for d1jz4b1.
(The format of our PDB-style files is described here.)

Timeline for d1jz4b1: