Lineage for d1jz3c2 (1jz3 C:626-730)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161124Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 161125Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 161126Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 161127Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 161165Domain d1jz3c2: 1jz3 C:626-730 [67741]
    Other proteins in same PDB: d1jz3a3, d1jz3a4, d1jz3a5, d1jz3b3, d1jz3b4, d1jz3b5, d1jz3c3, d1jz3c4, d1jz3c5, d1jz3d3, d1jz3d4, d1jz3d5

Details for d1jz3c2

PDB Entry: 1jz3 (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl enzyme intermediate

SCOP Domain Sequences for d1jz3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz3c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1jz3c2:

Click to download the PDB-style file with coordinates for d1jz3c2.
(The format of our PDB-style files is described here.)

Timeline for d1jz3c2: