Lineage for d1jz3b4 (1jz3 B:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781656Domain d1jz3b4: 1jz3 B:731-1023 [67738]
    Other proteins in same PDB: d1jz3a1, d1jz3a2, d1jz3a3, d1jz3a5, d1jz3b1, d1jz3b2, d1jz3b3, d1jz3b5, d1jz3c1, d1jz3c2, d1jz3c3, d1jz3c5, d1jz3d1, d1jz3d2, d1jz3d3, d1jz3d5
    complexed with 2dg, btb, dms, mg, na

Details for d1jz3b4

PDB Entry: 1jz3 (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl enzyme intermediate
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jz3b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz3b4 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jz3b4:

Click to download the PDB-style file with coordinates for d1jz3b4.
(The format of our PDB-style files is described here.)

Timeline for d1jz3b4: