Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (42 PDB entries) Uniprot P00722 |
Domain d1jz3a5: 1jz3 A:334-625 [67734] Other proteins in same PDB: d1jz3a1, d1jz3a2, d1jz3a3, d1jz3a4, d1jz3b1, d1jz3b2, d1jz3b3, d1jz3b4, d1jz3c1, d1jz3c2, d1jz3c3, d1jz3c4, d1jz3d1, d1jz3d2, d1jz3d3, d1jz3d4 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 1jz3 (more details), 1.75 Å
SCOPe Domain Sequences for d1jz3a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz3a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jz3a5:
View in 3D Domains from same chain: (mouse over for more information) d1jz3a1, d1jz3a2, d1jz3a3, d1jz3a4 |