Lineage for d1jz3a2 (1jz3 A:626-730)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290722Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 290723Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 290724Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 290725Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 290759Domain d1jz3a2: 1jz3 A:626-730 [67731]
    Other proteins in same PDB: d1jz3a3, d1jz3a4, d1jz3a5, d1jz3b3, d1jz3b4, d1jz3b5, d1jz3c3, d1jz3c4, d1jz3c5, d1jz3d3, d1jz3d4, d1jz3d5

Details for d1jz3a2

PDB Entry: 1jz3 (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl enzyme intermediate
PDB Compounds: (A:)

SCOP Domain Sequences for d1jz3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz3a2 b.1.4.1 (A:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1jz3a2:

Click to download the PDB-style file with coordinates for d1jz3a2.
(The format of our PDB-style files is described here.)

Timeline for d1jz3a2: