Lineage for d1jz2d1 (1jz2 D:220-333)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036363Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2036364Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2036378Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2036553Domain d1jz2d1: 1jz2 D:220-333 [67725]
    Other proteins in same PDB: d1jz2a3, d1jz2a4, d1jz2a5, d1jz2b3, d1jz2b4, d1jz2b5, d1jz2c3, d1jz2c4, d1jz2c5, d1jz2d3, d1jz2d4, d1jz2d5
    complexed with 2fg, btb, dms, mg, na

Details for d1jz2d1

PDB Entry: 1jz2 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jz2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz2d1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1jz2d1:

Click to download the PDB-style file with coordinates for d1jz2d1.
(The format of our PDB-style files is described here.)

Timeline for d1jz2d1: