Lineage for d1jz2c4 (1jz2 C:731-1023)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2052584Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2052585Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2052593Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 2052680Domain d1jz2c4: 1jz2 C:731-1023 [67723]
    Other proteins in same PDB: d1jz2a1, d1jz2a2, d1jz2a3, d1jz2a5, d1jz2b1, d1jz2b2, d1jz2b3, d1jz2b5, d1jz2c1, d1jz2c2, d1jz2c3, d1jz2c5, d1jz2d1, d1jz2d2, d1jz2d3, d1jz2d5
    complexed with 2fg, btb, dms, mg, na

Details for d1jz2c4

PDB Entry: 1jz2 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz2c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz2c4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jz2c4:

Click to download the PDB-style file with coordinates for d1jz2c4.
(The format of our PDB-style files is described here.)

Timeline for d1jz2c4: