Lineage for d1jz2b2 (1jz2 B:626-730)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105419Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 105420Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 105421Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 105422Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 105514Domain d1jz2b2: 1jz2 B:626-730 [67716]
    Other proteins in same PDB: d1jz2a3, d1jz2a4, d1jz2a5, d1jz2b3, d1jz2b4, d1jz2b5, d1jz2c3, d1jz2c4, d1jz2c5, d1jz2d3, d1jz2d4, d1jz2d5

Details for d1jz2b2

PDB Entry: 1jz2 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic)

SCOP Domain Sequences for d1jz2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz2b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1jz2b2:

Click to download the PDB-style file with coordinates for d1jz2b2.
(The format of our PDB-style files is described here.)

Timeline for d1jz2b2: