Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (3 species) |
Species Escherichia coli [TaxId:562] [51511] (45 PDB entries) Uniprot P00722 |
Domain d1jz2a5: 1jz2 A:334-625 [67714] Other proteins in same PDB: d1jz2a1, d1jz2a2, d1jz2a3, d1jz2a4, d1jz2b1, d1jz2b2, d1jz2b3, d1jz2b4, d1jz2c1, d1jz2c2, d1jz2c3, d1jz2c4, d1jz2d1, d1jz2d2, d1jz2d3, d1jz2d4 complexed with 2fg, btb, dms, mg, na |
PDB Entry: 1jz2 (more details), 2.1 Å
SCOPe Domain Sequences for d1jz2a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz2a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jz2a5:
View in 3D Domains from same chain: (mouse over for more information) d1jz2a1, d1jz2a2, d1jz2a3, d1jz2a4 |