Lineage for d1jz2a4 (1jz2 A:731-1023)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165166Superfamily b.30.5: Galactose mutarotase-like [74650] (4 families) (S)
  5. 165167Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 165168Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 165169Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 165214Domain d1jz2a4: 1jz2 A:731-1023 [67713]
    Other proteins in same PDB: d1jz2a1, d1jz2a2, d1jz2a3, d1jz2a5, d1jz2b1, d1jz2b2, d1jz2b3, d1jz2b5, d1jz2c1, d1jz2c2, d1jz2c3, d1jz2c5, d1jz2d1, d1jz2d2, d1jz2d3, d1jz2d5

Details for d1jz2a4

PDB Entry: 1jz2 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic)

SCOP Domain Sequences for d1jz2a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz2a4 b.30.5.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jz2a4:

Click to download the PDB-style file with coordinates for d1jz2a4.
(The format of our PDB-style files is described here.)

Timeline for d1jz2a4: