Lineage for d1jz2a1 (1jz2 A:220-333)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290722Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 290723Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 290724Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 290725Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 290814Domain d1jz2a1: 1jz2 A:220-333 [67710]
    Other proteins in same PDB: d1jz2a3, d1jz2a4, d1jz2a5, d1jz2b3, d1jz2b4, d1jz2b5, d1jz2c3, d1jz2c4, d1jz2c5, d1jz2d3, d1jz2d4, d1jz2d5

Details for d1jz2a1

PDB Entry: 1jz2 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic)
PDB Compounds: (A:)

SCOP Domain Sequences for d1jz2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz2a1 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jz2a1:

Click to download the PDB-style file with coordinates for d1jz2a1.
(The format of our PDB-style files is described here.)

Timeline for d1jz2a1: