Lineage for d1jz1p4 (1jz1 P:731-1023)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165166Superfamily b.30.5: Galactose mutarotase-like [74650] (4 families) (S)
  5. 165167Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 165168Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 165169Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 165269Domain d1jz1p4: 1jz1 P:731-1023 [67708]
    Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p5

Details for d1jz1p4

PDB Entry: 1jz1 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400

SCOP Domain Sequences for d1jz1p4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz1p4 b.30.5.1 (P:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jz1p4:

Click to download the PDB-style file with coordinates for d1jz1p4.
(The format of our PDB-style files is described here.)

Timeline for d1jz1p4: