Lineage for d1jz1o5 (1jz1 O:334-625)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116533Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 116534Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 116633Domain d1jz1o5: 1jz1 O:334-625 [67704]
    Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o4, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4

Details for d1jz1o5

PDB Entry: 1jz1 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400

SCOP Domain Sequences for d1jz1o5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz1o5 c.1.8.3 (O:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jz1o5:

Click to download the PDB-style file with coordinates for d1jz1o5.
(The format of our PDB-style files is described here.)

Timeline for d1jz1o5: