Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d1jz1o3: 1jz1 O:3-219 [67702] Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m4, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n4, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o4, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p4, d1jz1p5 complexed with 2fg, mg, na complexed with 2fg, mg, na |
PDB Entry: 1jz1 (more details), 2.6 Å
SCOPe Domain Sequences for d1jz1o3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz1o3 b.18.1.5 (O:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1jz1o3:
View in 3D Domains from same chain: (mouse over for more information) d1jz1o1, d1jz1o2, d1jz1o4, d1jz1o5 |
View in 3D Domains from other chains: (mouse over for more information) d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m4, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n4, d1jz1n5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p4, d1jz1p5 |