Lineage for d1jz1k3 (1jz1 K:3-219)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107983Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 107984Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families) (S)
  5. 108022Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 108023Protein beta-Galactosidase [49804] (1 species)
  7. 108024Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 108119Domain d1jz1k3: 1jz1 K:3-219 [67682]
    Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i4, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j4, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k4, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l4, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m4, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n4, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o4, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p4, d1jz1p5

Details for d1jz1k3

PDB Entry: 1jz1 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400

SCOP Domain Sequences for d1jz1k3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz1k3 b.18.1.5 (K:3-219) beta-Galactosidase {Escherichia coli}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jz1k3:

Click to download the PDB-style file with coordinates for d1jz1k3.
(The format of our PDB-style files is described here.)

Timeline for d1jz1k3: