Lineage for d1jz0h3 (1jz0 H:3-219)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107983Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 107984Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families) (S)
  5. 108022Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 108023Protein beta-Galactosidase [49804] (1 species)
  7. 108024Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 108116Domain d1jz0h3: 1jz0 H:3-219 [67667]
    Other proteins in same PDB: d1jz0a1, d1jz0a2, d1jz0a4, d1jz0a5, d1jz0b1, d1jz0b2, d1jz0b4, d1jz0b5, d1jz0c1, d1jz0c2, d1jz0c4, d1jz0c5, d1jz0d1, d1jz0d2, d1jz0d4, d1jz0d5, d1jz0e1, d1jz0e2, d1jz0e4, d1jz0e5, d1jz0f1, d1jz0f2, d1jz0f4, d1jz0f5, d1jz0g1, d1jz0g2, d1jz0g4, d1jz0g5, d1jz0h1, d1jz0h2, d1jz0h4, d1jz0h5

Details for d1jz0h3

PDB Entry: 1jz0 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains a-h, see remark 400

SCOP Domain Sequences for d1jz0h3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz0h3 b.18.1.5 (H:3-219) beta-Galactosidase {Escherichia coli}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jz0h3:

Click to download the PDB-style file with coordinates for d1jz0h3.
(The format of our PDB-style files is described here.)

Timeline for d1jz0h3: