Lineage for d1jz0h1 (1jz0 H:220-333)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 455233Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 455234Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 455235Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 455236Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
  8. 455395Domain d1jz0h1: 1jz0 H:220-333 [67665]
    Other proteins in same PDB: d1jz0a3, d1jz0a4, d1jz0a5, d1jz0b3, d1jz0b4, d1jz0b5, d1jz0c3, d1jz0c4, d1jz0c5, d1jz0d3, d1jz0d4, d1jz0d5, d1jz0e3, d1jz0e4, d1jz0e5, d1jz0f3, d1jz0f4, d1jz0f5, d1jz0g3, d1jz0g4, d1jz0g5, d1jz0h3, d1jz0h4, d1jz0h5

Details for d1jz0h1

PDB Entry: 1jz0 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains a-h, see remark 400

SCOP Domain Sequences for d1jz0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz0h1 b.1.4.1 (H:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jz0h1:

Click to download the PDB-style file with coordinates for d1jz0h1.
(The format of our PDB-style files is described here.)

Timeline for d1jz0h1: