Lineage for d1jz0e5 (1jz0 E:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173523Domain d1jz0e5: 1jz0 E:334-625 [67654]
    Other proteins in same PDB: d1jz0a1, d1jz0a2, d1jz0a3, d1jz0a4, d1jz0b1, d1jz0b2, d1jz0b3, d1jz0b4, d1jz0c1, d1jz0c2, d1jz0c3, d1jz0c4, d1jz0d1, d1jz0d2, d1jz0d3, d1jz0d4, d1jz0e1, d1jz0e2, d1jz0e3, d1jz0e4, d1jz0f1, d1jz0f2, d1jz0f3, d1jz0f4, d1jz0g1, d1jz0g2, d1jz0g3, d1jz0g4, d1jz0h1, d1jz0h2, d1jz0h3, d1jz0h4

Details for d1jz0e5

PDB Entry: 1jz0 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains a-h, see remark 400

SCOP Domain Sequences for d1jz0e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz0e5 c.1.8.3 (E:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jz0e5:

Click to download the PDB-style file with coordinates for d1jz0e5.
(The format of our PDB-style files is described here.)

Timeline for d1jz0e5: