Lineage for d1jyzn5 (1jyz N:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173552Domain d1jyzn5: 1jyz N:334-625 [67619]
    Other proteins in same PDB: d1jyzi1, d1jyzi2, d1jyzi3, d1jyzi4, d1jyzj1, d1jyzj2, d1jyzj3, d1jyzj4, d1jyzk1, d1jyzk2, d1jyzk3, d1jyzk4, d1jyzl1, d1jyzl2, d1jyzl3, d1jyzl4, d1jyzm1, d1jyzm2, d1jyzm3, d1jyzm4, d1jyzn1, d1jyzn2, d1jyzn3, d1jyzn4, d1jyzo1, d1jyzo2, d1jyzo3, d1jyzo4, d1jyzp1, d1jyzp2, d1jyzp3, d1jyzp4

Details for d1jyzn5

PDB Entry: 1jyz (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains i-p, see remark 400.

SCOP Domain Sequences for d1jyzn5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyzn5 c.1.8.3 (N:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jyzn5:

Click to download the PDB-style file with coordinates for d1jyzn5.
(The format of our PDB-style files is described here.)

Timeline for d1jyzn5: