Lineage for d1jyzn4 (1jyz N:731-1023)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165166Superfamily b.30.5: Galactose mutarotase-like [74650] (4 families) (S)
  5. 165167Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 165168Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 165169Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 165287Domain d1jyzn4: 1jyz N:731-1023 [67618]
    Other proteins in same PDB: d1jyzi1, d1jyzi2, d1jyzi3, d1jyzi5, d1jyzj1, d1jyzj2, d1jyzj3, d1jyzj5, d1jyzk1, d1jyzk2, d1jyzk3, d1jyzk5, d1jyzl1, d1jyzl2, d1jyzl3, d1jyzl5, d1jyzm1, d1jyzm2, d1jyzm3, d1jyzm5, d1jyzn1, d1jyzn2, d1jyzn3, d1jyzn5, d1jyzo1, d1jyzo2, d1jyzo3, d1jyzo5, d1jyzp1, d1jyzp2, d1jyzp3, d1jyzp5

Details for d1jyzn4

PDB Entry: 1jyz (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains i-p, see remark 400.

SCOP Domain Sequences for d1jyzn4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyzn4 b.30.5.1 (N:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jyzn4:

Click to download the PDB-style file with coordinates for d1jyzn4.
(The format of our PDB-style files is described here.)

Timeline for d1jyzn4: