Lineage for d1jyzn3 (1jyz N:3-219)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662086Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 662087Protein beta-Galactosidase [49804] (2 species)
  7. 662095Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
  8. 662225Domain d1jyzn3: 1jyz N:3-219 [67617]
    Other proteins in same PDB: d1jyzi1, d1jyzi2, d1jyzi4, d1jyzi5, d1jyzj1, d1jyzj2, d1jyzj4, d1jyzj5, d1jyzk1, d1jyzk2, d1jyzk4, d1jyzk5, d1jyzl1, d1jyzl2, d1jyzl4, d1jyzl5, d1jyzm1, d1jyzm2, d1jyzm4, d1jyzm5, d1jyzn1, d1jyzn2, d1jyzn4, d1jyzn5, d1jyzo1, d1jyzo2, d1jyzo4, d1jyzo5, d1jyzp1, d1jyzp2, d1jyzp4, d1jyzp5

Details for d1jyzn3

PDB Entry: 1jyz (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains i-p, see remark 400.
PDB Compounds: (N:) beta-galactosidase

SCOP Domain Sequences for d1jyzn3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyzn3 b.18.1.5 (N:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1jyzn3:

Click to download the PDB-style file with coordinates for d1jyzn3.
(The format of our PDB-style files is described here.)

Timeline for d1jyzn3: