Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
Domain d1jyzn2: 1jyz N:626-730 [67616] Other proteins in same PDB: d1jyzi3, d1jyzi4, d1jyzi5, d1jyzj3, d1jyzj4, d1jyzj5, d1jyzk3, d1jyzk4, d1jyzk5, d1jyzl3, d1jyzl4, d1jyzl5, d1jyzm3, d1jyzm4, d1jyzm5, d1jyzn3, d1jyzn4, d1jyzn5, d1jyzo3, d1jyzo4, d1jyzo5, d1jyzp3, d1jyzp4, d1jyzp5 complexed with 2fl, mg, na complexed with 2fl, mg, na |
PDB Entry: 1jyz (more details), 2.7 Å
SCOPe Domain Sequences for d1jyzn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyzn2 b.1.4.1 (N:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jyzn2:
View in 3D Domains from same chain: (mouse over for more information) d1jyzn1, d1jyzn3, d1jyzn4, d1jyzn5 |
View in 3D Domains from other chains: (mouse over for more information) d1jyzi1, d1jyzi2, d1jyzi3, d1jyzi4, d1jyzi5, d1jyzj1, d1jyzj2, d1jyzj3, d1jyzj4, d1jyzj5, d1jyzk1, d1jyzk2, d1jyzk3, d1jyzk4, d1jyzk5, d1jyzl1, d1jyzl2, d1jyzl3, d1jyzl4, d1jyzl5, d1jyzm1, d1jyzm2, d1jyzm3, d1jyzm4, d1jyzm5, d1jyzo1, d1jyzo2, d1jyzo3, d1jyzo4, d1jyzo5, d1jyzp1, d1jyzp2, d1jyzp3, d1jyzp4, d1jyzp5 |