Lineage for d1jyzn1 (1jyz N:220-333)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366897Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 366898Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 366899Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 366900Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 367135Domain d1jyzn1: 1jyz N:220-333 [67615]
    Other proteins in same PDB: d1jyzi3, d1jyzi4, d1jyzi5, d1jyzj3, d1jyzj4, d1jyzj5, d1jyzk3, d1jyzk4, d1jyzk5, d1jyzl3, d1jyzl4, d1jyzl5, d1jyzm3, d1jyzm4, d1jyzm5, d1jyzn3, d1jyzn4, d1jyzn5, d1jyzo3, d1jyzo4, d1jyzo5, d1jyzp3, d1jyzp4, d1jyzp5

Details for d1jyzn1

PDB Entry: 1jyz (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains i-p, see remark 400.

SCOP Domain Sequences for d1jyzn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyzn1 b.1.4.1 (N:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1jyzn1:

Click to download the PDB-style file with coordinates for d1jyzn1.
(The format of our PDB-style files is described here.)

Timeline for d1jyzn1: