Class b: All beta proteins [48724] (174 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (25 PDB entries) Uniprot P00722 |
Domain d1jyyh4: 1jyy H:731-1023 [67588] Other proteins in same PDB: d1jyya1, d1jyya2, d1jyya3, d1jyya5, d1jyyb1, d1jyyb2, d1jyyb3, d1jyyb5, d1jyyc1, d1jyyc2, d1jyyc3, d1jyyc5, d1jyyd1, d1jyyd2, d1jyyd3, d1jyyd5, d1jyye1, d1jyye2, d1jyye3, d1jyye5, d1jyyf1, d1jyyf2, d1jyyf3, d1jyyf5, d1jyyg1, d1jyyg2, d1jyyg3, d1jyyg5, d1jyyh1, d1jyyh2, d1jyyh3, d1jyyh5 complexed with 2fl, mg, na |
PDB Entry: 1jyy (more details), 2.7 Å
SCOPe Domain Sequences for d1jyyh4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyyh4 b.30.5.1 (H:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1jyyh4:
View in 3D Domains from same chain: (mouse over for more information) d1jyyh1, d1jyyh2, d1jyyh3, d1jyyh5 |
View in 3D Domains from other chains: (mouse over for more information) d1jyya1, d1jyya2, d1jyya3, d1jyya4, d1jyya5, d1jyyb1, d1jyyb2, d1jyyb3, d1jyyb4, d1jyyb5, d1jyyc1, d1jyyc2, d1jyyc3, d1jyyc4, d1jyyc5, d1jyyd1, d1jyyd2, d1jyyd3, d1jyyd4, d1jyyd5, d1jyye1, d1jyye2, d1jyye3, d1jyye4, d1jyye5, d1jyyf1, d1jyyf2, d1jyyf3, d1jyyf4, d1jyyf5, d1jyyg1, d1jyyg2, d1jyyg3, d1jyyg4, d1jyyg5 |