Lineage for d1jyyg5 (1jyy G:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173545Domain d1jyyg5: 1jyy G:334-625 [67584]
    Other proteins in same PDB: d1jyya1, d1jyya2, d1jyya3, d1jyya4, d1jyyb1, d1jyyb2, d1jyyb3, d1jyyb4, d1jyyc1, d1jyyc2, d1jyyc3, d1jyyc4, d1jyyd1, d1jyyd2, d1jyyd3, d1jyyd4, d1jyye1, d1jyye2, d1jyye3, d1jyye4, d1jyyf1, d1jyyf2, d1jyyf3, d1jyyf4, d1jyyg1, d1jyyg2, d1jyyg3, d1jyyg4, d1jyyh1, d1jyyh2, d1jyyh3, d1jyyh4

Details for d1jyyg5

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.

SCOP Domain Sequences for d1jyyg5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyyg5 c.1.8.3 (G:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jyyg5:

Click to download the PDB-style file with coordinates for d1jyyg5.
(The format of our PDB-style files is described here.)

Timeline for d1jyyg5: