SCOPe 2.02: Domain d1jyyg2: 1jyy G:626-730

Lineage for d1jyyg2 (1jyy G:626-730)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
   Uniprot P00722

8. Domain d1jyyg2: 1jyy G:626-730 [67581]
   Other proteins in same PDB: d1jyya3, d1jyya4, d1jyya5, d1jyyb3, d1jyyb4, d1jyyb5, d1jyyc3, d1jyyc4, d1jyyc5, d1jyyd3, d1jyyd4, d1jyyd5, d1jyye3, d1jyye4, d1jyye5, d1jyyf3, d1jyyf4, d1jyyf5, d1jyyg3, d1jyyg4, d1jyyg5, d1jyyh3, d1jyyh4, d1jyyh5
   complexed with 2fl, mg, na

Details for d1jyyg2

PDB Entry: 1jyy, 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.

PDB Compounds: (G:) beta-galactosidase

SCOPe Domain Sequences for d1jyyg2:

Sequence; same for both SEQRES and ATOM records:

>d1jyyg2 b.1.4.1 (G:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

Timeline for d1jyyg2:

• d1jyyg2 first appeared in SCOP 1.59
  
• d1jyyg2 appears in SCOPe 2.01
  
• d1jyyg2 appears in SCOPe 2.03
  
• d1jyyg2 appears in the current release, SCOPe 2.08