Lineage for d1jyyf4 (1jyy F:731-1023)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109072Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 109073Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 109074Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 109075Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 109185Domain d1jyyf4: 1jyy F:731-1023 [67578]
    Other proteins in same PDB: d1jyya1, d1jyya2, d1jyya3, d1jyya5, d1jyyb1, d1jyyb2, d1jyyb3, d1jyyb5, d1jyyc1, d1jyyc2, d1jyyc3, d1jyyc5, d1jyyd1, d1jyyd2, d1jyyd3, d1jyyd5, d1jyye1, d1jyye2, d1jyye3, d1jyye5, d1jyyf1, d1jyyf2, d1jyyf3, d1jyyf5, d1jyyg1, d1jyyg2, d1jyyg3, d1jyyg5, d1jyyh1, d1jyyh2, d1jyyh3, d1jyyh5

Details for d1jyyf4

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.

SCOP Domain Sequences for d1jyyf4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyyf4 b.30.1.1 (F:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1jyyf4:

Click to download the PDB-style file with coordinates for d1jyyf4.
(The format of our PDB-style files is described here.)

Timeline for d1jyyf4: